PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G72980.1
Common NameASL31, F3N23.18, LBD7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 214aa    MW: 24846.3 Da    PI: 8.2061
Description LOB domain-containing protein 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G72980.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.82.1e-39131131101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++r+kC+k+C+la+yfp++ ++kf n+hklFG+sn++k+lk+++e++r++am+ l+y+A+ara dPv G++++i +l+ ++e +++el+l++
  AT1G72980.1  13 ACAACKHQRKKCKKNCILARYFPQDGTNKFLNAHKLFGVSNITKMLKRIEESQRDIAMENLIYHANARALDPVGGVYRTICDLKCKIEFVQTELNLTR 110
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  +++
  AT1G72980.1 111 QQI 113
                  986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.93512113IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MSLSTFSGGS TTACAACKHQ RKKCKKNCIL ARYFPQDGTN KFLNAHKLFG VSNITKMLKR  60
IEESQRDIAM ENLIYHANAR ALDPVGGVYR TICDLKCKIE FVQTELNLTR QQIDMCRSLA  120
QEQHRQRQNL PYRCNSFESL LQQDGDEYVN VDGLDHQNMQ QQQEMQQQQQ NPSNYDMFLE  180
MPEQTSKVKL EEEKISDQRK NNLMRQILMS SAII
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402543600.0
Expression AtlasAT1G72980-
AtGenExpressAT1G72980-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G72980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G72980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738640.0AB473864.1 Arabidopsis thaliana ASL31 mRNA for ASYMMETRIC LEAVES2-like 31 protein, complete cds.
GenBankAC0080170.0AC008017.2 Arabidopsis thaliana chromosome I BAC F3N23 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177441.11e-160LOB domain-containing protein 7
SwissprotQ9SSM91e-162LBD7_ARATH; LOB domain-containing protein 7
TrEMBLD7KR591e-102D7KR59_ARALL; LOB domain family protein
STRINGAT1G72980.11e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Representative plantOGRP55241021
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]